PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00128451001
Common NameGSBRNA2T00128451001, LOC106356268
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 173aa    MW: 18669.1 Da    PI: 7.773
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00128451001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.21.6e-44131121100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca+dCv++pyfpa++p+kfanvh++FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l
  GSBRNA2T00128451001  13 PCAACKLLRRRCAQDCVFSPYFPADEPQKFANVHRVFGASNVNKMLQELPIHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVL 102
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +lal+++e
  GSBRNA2T00128451001 103 QGQLALAQAE 112
                          *****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.09612113IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-4413110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MKESSRKQGA ASPCAACKLL RRRCAQDCVF SPYFPADEPQ KFANVHRVFG ASNVNKMLQE  60
LPIHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID VLQGQLALAQ AEVVHLRVRH  120
STNFPGNGLC PDSPSSSGSP SSKQVSPQDN KGIFSHMDMV DEASLGESMW SC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00128451001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738391e-169AB473839.1 Arabidopsis thaliana ASL6 mRNA for ASYMMETRIC LEAVES2-like 6 protein, complete cds.
GenBankBT0150671e-169BT015067.1 Arabidopsis thaliana At1g31320 gene, complete cds.
GenBankBT0156651e-169BT015665.1 Arabidopsis thaliana At1g31320 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009102666.11e-126PREDICTED: LOB domain-containing protein 4
RefseqXP_013651510.11e-126PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE91e-106LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A078CR171e-126A0A078CR17_BRANA; BnaA07g06910D protein
TrEMBLM4DEI61e-126M4DEI6_BRARP; Uncharacterized protein
STRINGBra014907.1-P1e-126(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-102LOB domain-containing protein 4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]